PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10013892m
Common NameEUTSA_v10013892mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SBP
Protein Properties Length: 366aa    MW: 39752 Da    PI: 8.1186
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10013892mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.71.2e-41111188178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +C v+gC++d+s+++eyh+rhkvCevhsk+pvv+++g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Thhalv10013892m 111 ICLVDGCDSDFSNCREYHKRHKVCEVHSKTPVVTINGHKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 188
                      5**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-33105173IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.017109186IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-39110192IPR004333Transcription factor, SBP-box
PfamPF031101.4E-30112185IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDWNFKLSSG YLSEFDQESV PVSTPIDGSI SFGGSSSSSS SRLQPKGNFS FDLKLGRNTG  60
NSSFSAFGNT EQVISLSKWK ESAITKPEAS RSSGSSKRTR GNGLGNNQIP ICLVDGCDSD  120
FSNCREYHKR HKVCEVHSKT PVVTINGHKQ RFCQQCSRFH SLEEFDEGKR SCRKRLDGHN  180
RRRRKPQPDH IARPANFFTG FEGSKLLEFS GASHVFPTTS VASPSWGNGL VSVAMANGSV  240
YRQNQGFPGS SPAKTGIMFP ISSSPDNRGK QFPFLQEEES SRTASLCERM TSCIHDSDCA  300
LSLLSSSSSS VPHLVQQPVS LSQEAVETVF YGSGLFENAS AVSDGSVISG SEAVALPQTF  360
PFHWE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29105185484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168185KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402078.10.0hypothetical protein EUTSA_v10013892mg
SwissprotB9DI200.0SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI110.0SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLV4NC710.0V4NC71_EUTSA; Uncharacterized protein
STRINGscaffold_801495.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41112759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.10.0SBP family protein